qq slot terbaru 2019 cashback 100-🎖️cara login rajapoker88 di android|XOXE88.COM

PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologqq slot terbaru 2019 cashback 100ikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.

IrjenFerdySambosaattibadimarkasBareskrimPolri,Kamis(4/8)pagi.Foto:Ricardo/JPNNjpnn.com,JAKARTA-InspekturJenderalFerdySambomemohonmaafkepadaPolriatasinsidenkematianBrigadirYosuaHutabaratatauBrigadirJdirumahdinasnya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Jenderalbintangduatersebutmenyampaikanpermohonannyaitudidepanawakmedia,saattibadilobiBareskrimPolri,Kamis(4/8)sekitarpukul09.55WIB.IrjenFerdySambodatangkeBareskrimuntukdiperiksadalamkasuspembunuhanBrigadirJ.BacaJuga:LihatTampangIrjenFerdySamboSebelumDigarapBareskrimPolriKasusitusendiritelahmemunculkantersangka,yakniBhayangkaraDuaRichardEliezeratauBharadaE.Sayainginmenyampaikanpermohonanmaafkepadainstitusi(Polri)terkaitdenganperistiwayangterjadidirumahdinassayadiDurenTiga,kataPakSambo.KadivPropamnonaktifkelahiranKabupatenBarru,SulawesiSelatan,9Februari1973inijugamenyampaikanbelasungkawaatasmeninggalnyaBrigadirJ.BacaJuga:MengenalIrjenFerdySambo:AnakJenderal,PerwiraMetropolitanyangTakPernahkeLuarJawaSemogakeluargadiberikankekuatan.Namun,semuaituterlepasdariapayangtelahdilakukanYosuakepadaistridankeluargasaya,katanya.FerdySambomenyebutkankehadirandirinyamemenuhipanggilanpenyidikinibukanyangpertamakali.AnggaWijaya.Foto:Instagram/anggawijaya88jpnn.com,JAKARTA-AnggaWijayakembalimembeberkanpenyebabdirinyamantapberceraidenganDewiPerssik.SalahsatunyalantaranmendengarlangsungpernyataandariDewiPerssik.SaatditanyakalimatapayangdikatakanDewiPerssiktentangdirinya,AnggaWijayaengganmembeberkannya.BacaJuga:MerasaDapatTekananMenikahdenganDewiPerssik,AnggaWijaya:NengTidakBahagiaSamaSayaAkupernahmendengarstatementdaribeliaulangsung.Mungkinbeliauenggaktahuakudengar.Sampaiakhirnyaakuokebulat(gugatcerai),seruAnggaWijaya.Mantanpegawaibankinimeyakinijikamemaksakandiritetapmempertahankanrumahtanggayangtidakbaik-baiksaja,makaitusikapyangegois.Kalauenggakbegituakunyaegois.Akuresearchselamaduabulan,sampaibenarbulatakuambilkeputusan(bercerai),kataAnggaWijaya.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?JasaRaharjaSerahkanSantunanKepadaAhliWarisKorbanKecelakaanKendaraanDinasBakamlaDiapunmemintamaafkepadaDewiPerssik,jikaselamamenjadisuamitidakbisasepertiyangdiharapkan.Akubanyakkekurangannya,akusadar,ucapAnggaWijaya.(chi/jpnn)VideoTerpopulerHariini:qq slot terbaru 2019 cashback 100

qq slot terbaru 2019 cashback 100-🎖️cara login rajapoker88 di android|XOXE88.COM

KepalaDivisiProfesidanPengamanannonaktifIrjenFerdySambomenjalanipemeriksaansebagaisaksikasuspembunuhanBrigadirJ,digedungBareskrimPolri,Jakarta,Kamis(4/8).Foto:Ricardojpnn.com,JAKARTA-KepalanonaktifDivisiPropamPolriIrjenFerdySambomemenuhipanggilanpemeriksaanpenyidikBareskrimPolripadaKamis(4/8)hariini.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});FerdySambotampakmengenakanpakaiandinasharian(PDH)Polriketikatibapukul09.56WIB.DiamenggunakanmobilToyotaKijangInnovaberwarnahitamkemarkasyangdipimpinolehKomjenAgusAndriantoitu.BacaJuga:IrjenFerdySambo:SayaInginMenyampaikanPermohonanMaafDiaakandiperiksasebagaisaksikasuskematianyangmenewaskanBrigadirNofryansahYosuaHutabaratatauBrigadirJ.Daripantauan,eksKoorspripimKapolriitumengenakanPDHdengantandakorpskesatuanPropamPolridibahusisikanandansisikirinya.Taklupapula,suamiPutriCandrawathiitumengenakantandapangkatbintangduadikeduapundaknya.BacaJuga:IrjenFerdySamboBukaSuarakeMedia,SebutNamaBrigadirYosuaSayahadirmemenuhipanggilanpenyidikBareskrimPolri.Pemeriksaanhariiniadalahpemeriksaanyangkeempat.SayasudahmemberikanketerangankepadapenyidikPolresJaksel,PoldaMetroJaya,dansekarangyangkeempatdiBareskrimPolri,kataSambodiBareskrimPolri,Kamis.FerdyitumemintamaafkepadaKorpsBhayangkaraatasinsidenberdarahdirumahnya.KepalaDivisiProfesidanPengamanannonaktifIrjenFerdySambomenjalanipemeriksaansebagaisaksikasustewasnyaBrigadirJ,digedungBareskrimPolri,Jakarta,Kamis(4/8).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KadivPropamPorlinonaktifIrjenFerdySambomemintamaafkepadaKorpsBhayangkaraatasinsidenyangmenewaskanBrigadirNofryansahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidentersebutmelibatkanBhadaraEdanBrigadirJdirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatanpadaJumat(8/7).SayajugainginmenyampaikanpermohonanmaafkepadainstitusiterkaitperistiwayangterjadidirumahdinassayadiDurenTiga,kataFerdySambodiBareskrimPolri,Kamis(4/8).BacaJuga:BharadaEJadiTersangkaKasusKematianBrigadirJ,BeginiReaksiKamaruddinSimanjuntakJenderalbintangduaitukemudianmenyampaikanbelasungkawaterhadapkeluargaBrigadirJ.FerdySamboberharapkeluargaBrigadirJdiberikankekuatan.Namun,semuaituterlepasdariapayangtelahdilakukanSaudaraYosuakepadaistridankeluargasaya,ujarFerdySambo.BacaJuga:IrjenFerdySamboBukaSuarakeMedia,SebutNamaBrigadirYosuaSelainitu,FerdySambomemintamasyarakatagartidakberspekulasiliaratasinsidentewasnyaBrigadirJ.Sayaharapkankepadaseluruhpihak-pihakdanmasyarakatuntukbersabar,tidakmemberikanasumsi,persepsiperistiwadirumahdinassaya,tambahnya.KabareskrimPolriKomjenAgusAndrianto.Foto:sourceforJPNN.comjpnn.com,JAKARTA-KabareskrimPolriKomjenAgusAndriantomengungkapalasanpihaknyatidakmenjeratBharadaRichardEliezeratauEdenganPasal340KUHPtentangPembunuhanBerencana.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BharadaEhanyadijeratPasal338KUHPtentangPembunuhanjunctoPasal55danPasal56KUHPdalamkasuskematianBrigadirNofriansyahYosuaHutabaratatauJ.MenurutAgus,kasusyangmenjeratBharadaEinimasihberprosesdiDirektoratTindakPidanaUmum(Dittipidum)Bareskrim,sehinggamasihadapotensipasallainyangditerapkan.BacaJuga:FerdySamboBerbelasungkawa,ResponsKeluargaBrigadirJMenohokKenapatidakditerapkanPasal340KUHP,karenainimasihrangkaianprosespendalamandaritemuan-temuaqq slot terbaru 2019 cashback 100nselamapemeriksaanolehtimsus,kataAguskepadawartawandiBareskrimPolri,Kamis(4/8).Timkhusussedangmemeriksa25personelkepolisiandalamkasuskematianBrigadirJ.PuluhanpersonelpolisitersebutdiperiksakarenadidugatidakprofesionaldalampenanganankasusdilokasikejadianpenembakanyangterjadidirumahdinasIrjenFerdySamboitu.BacaJuga:IrjenSyahardiantonoDitunjukSebagaiKadivPropamGantikanFerdySamboPerinciandaripuluhanpersonelitu,yaknitigapersonelberpangkatpati(perwiratinggi)bintangsatu,limapersonelberpangkatkombes,tigapersonelberpangkatAKBP,duapersonelberpangkatkompol,tujuhpersonelberpangkatperwirapertama(pama),danlimapersonelberpangkatbintaradantamtama.Ke-25orangituberasaldarikesatuanPropam,PolresMetroJakartaSelatan,PoldaMetroJaya,danBareskrimPolri.PengacaraHotmanParis.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismengakukerapdihubungiolehmantanasistenpribadinya(aspri)IqlimaKim.Diamenyebutperempuanitujugamengundanguntukdatangkeulangtahunnyabeberapawaktulalu.BacaJuga:DituduhMenciumIqlimaKimdiMobil,RazmanArifNasutionBeriTanggapanDiaterus-terusanmengundangsaya,tetapisayaenggakmau,ujarHotmanParisdikawasanKelapaGading,JakartaUtara,Kamis(4/8).BacaJuga:KuasaHukumSebutIstriIrjenFerdyHarusDianggapBenar,SampaiNamun,diaogahdatangkepestaulangtahunmantanasprinyaitu.AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezeratauBharadaEtersangkapembunuhanBrigadirJ.Foto:Ricardo/JPNNjpnn.com,JAKARTA-BhayangkaraDuaE(RichardEliezer)aliasBharadaEternyatamasihpunyakesempatandilindungiolehLembagaPerlindunganSaksidanKorban(LPSK)meskipunberstatustersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BharadaEditetapkanjaditersangkapembunuhanNofriansyahYosuaHutabaratatauBrigadirJpadaRabu(3/8)malam.AnggotaBrimobPolriyangsudahmendekamdiRutanBareskrimPolriitusebelumnyamengajukanpermohonanperlindungankeLPSK.BacaJuga:BharadaETersangka,RezaBeberAnalisisMatematikaKejahatanTerencanaKetuaLPSKHastoAtmojoSuroyomenyatakanlembaganyasudahtidakpunyakewenanganmemberiperlindungankepadaBharadaEyangsudahjaditersangkapembunuhan.Namundemikian,peluangbagiajudanmantanKadivPropamPolriIrjenFerdySamboitumendapatperlindunganLPSKmasihterbuka.LPSKtidakadakewenanganlagimemberikanperlindungankecualiyangbersangkutanbersediamenjadijusticecollaboratorataupelakuyangbekerjasamadalammengungkapkasus,kataHastosaatdihubungidiJakarta,Kamis(4/8).BacaJuga:BharadaEMenyampaikanSesuatuyangAkanMengancamnyaDialantasmenyebutbahwadenganpasalyangmenjeratBharadaE,yakniPasal338junctoPasal55danPasal56KUHPbisamenjadipeluangbagiEliezermenjaditerlindungLPSK.Namun,keputusanberpulangkepadayangbersangkutanapakahbersediaatautidakmenjadijusticecollaboratoraliasJCgunamengungkapkematianBrigadirJ.

IrjenFerdySambokenamutasiKapolri.IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-KapolriJenderalListyoSigitPrabowomengeluarkantelegramkhususberisimutasiterhadapbelasananakbuahnya.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KeputusanitudiambilbuntutkematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.BrigadirJdisebuttewasusaiterlibatbakutembakdenganBharadaEdirumahdinasIrjenFerdySambopadaJumat(8/7).BacaJuga:KuasaHukumSebutIstriIrjenFerdyHarusDianggapBenar,SampaiBharadaEsendiritelahditetapkansebagaitersangkadalamkasustersebut.MalamhariinisayakeluarkantelegramkhususuntukmemutasidantentunyaharapansayaprosespenanganantindakpidanaterkaitmeninggalnyaBrigadirYosuakedepanakanberjalanbaik,kataListyodiBareskrimPolri,Kamis(4/8).Tercatat,ada15anggotaPolriyangdimutasiolehKapolriJenderalListyo.BacaJuga:KapolriDepakIrjenFerdySambo,OrangNomor2diBareskrimJadiKadivPropamMutasiitutertuangdalamSuratTelegramNomor1628/VIII/Kep/2022tertanggal4Agustus2022.BeberapanamayangsebelumnyadinonaktikanolehorangnomorsatudiKorpsBhayangkaraituturutdimutasi.DewiPerssik.Foto:FirdaJunita/JPNNjpnn.com,JAKARTA-PedangdutDewiPerssikmengungkapfaktamengejutkansoalmantansuaminya,AnggaWijaya.PelantunHikayatCintainimengakusempatmenolakdiajakberhubunganintimolehAnggadalamwaktuyanglama.DewiPerssikmengatakanhalitulantarandirinyakecewadengansangmantanyangkerapmengambiluangtanpaizin.BacaJuga:PesanuntukAnggaWijaya,DewiPerssik:StopMengomongMacam-macamAkutidakmelayanisuamikukarenaakudongkol,kesal,kataDepe-sapaannyasaatdiacaraPagiPagiAmbyarTransTV.Diapunmengakuhanyabisamenangisdikamarmengetahuisuaminyakalaitumalahmelakukanhaltersebut.Padahal,kataDepe,diakerapmengingatkanAnggaWijayaagartidakmengambiluangistri.BacaJuga:BerceraidariDewiPerssik,AnggaWijayaJatuhMiskin?Akusindirdiabiarterbuka,tetapimalahketawa-ketawa,tuturDepelalumenangis.PemiliknamaasliDewiMuriaAgunginipunmenyayangkansikapdankelakuansangmantankalaitu.PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.

TunggalputriIndia,PusarlaV.Sindhu..Foto:BadmintonPhoto-BWFjpnn.com,BIRMINGHAM-IndiamemborongtigamedaliemasdariajangCommonwealthGames2022yangdihelatdiBirmingham,Inggris.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TigawakilIndiayangsuksesnaikpodiumtertinggiantaralainLakshyaSen(tunggalputra),PusarlaV.Sindhu(tunggalputri),sertaChiragShetty/SatwiksairajRankireddy(gandaputra).LakshyaSenmerebutemasseusaimengalahkantunggaputraMalaysia,NgTzeYong.BacaJuga:AFCCup2022:PrediksiSusunanPemainPSMMakassarvsKedahFCPemainranking10duniaitumengalahkanTzeYonglewatpertarungantigagimdenganskor19-21,21-19,21-16.KemenanganSendiikutiolehrunnerupOlimpiadeRio2016,PusarlaV.Sindhu.KampiunSingaporeOpen2022itumenangdenganskor21-15,21-13atasMichelleLi(Kanada).SatulagiwakilIndiayangberjayadiCommonwealthGames2022ialahChiragShetty/SatwiksairajRankireddy.BacaJuga:CommonwealthGames2022:NgTzeYongMenggila,LeeChongWeiBeriPetuahPentingJawaraIndiaOpen2022itumengatasiperlawananwakiltuanrumahBenLane/SeanVendyduagimlangsung,21-15,21-13.Dengankemenanganini,Indiatercatatmembawapulangtigamedaliemasdarisektorperorangancaborbulutangkis.HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).FotoIlustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});InvestasisafeheavenberbalikmenguatdaripenurunanakhirpekanlaludanbertenggerdiataslevelpsikologisUSD1.800perounce.PenguatanhargaemasditopangolehgreenbackyanglebihlemahmenjelanglaporaninflasiutamaAmerikaSerikat.BacaJuga:HargaEmasPegadaian,Sabtu6Agustus2022,AntamdanUBSKompakNaikKontrakemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,terdongkrakUSD14atau0,78persen,menjadiditutuppadaUSD1.805,20perounce.EmasberjangkaanjlokUSD15,7atau0,87persenmenjadiUSD1.791,20padaJumat(5/8),setelahmelonjakUSD30,5atau1,72persenmenjadiUSD1.806,90padaKamis(4/8).IndeksUSDyangmengukurgreenbackterhadapenammatauangutamalainnya,turun0,17persenmenjadi106,4360,karenainvestormenunggudatainflasiASyangakandirilispadaRabu(10/8),membuatemaslebihmurahbagipemegangmatauanglainnya.BacaJuga:HargaEmasHariIniMerosotTajam,AmbyarEmasjugamenemukandukungantambahandariimbalhasilobligasipemerintahASyangturundanpembalikankeuntunganawalpadasaham-sahamAS.JikaWallStreetdanaset-asetberisikotetapdalamtrenpasarbearish,makakitaharusmengabaikansinyalinidenganrisikokitasendiri,kataanalisekuitasStoneX,FawadRazaqzadadalamkomentarnyapadaSenin(8/8).PengacaraBharadaE,DeolipaYumaradanMuhammadBurhanuddindikantorLPSK,JakartaTimur,Senin(8/8).jpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangSenin(8/8)tentangBharadaEmengakusudahlegakarenamembongkarkasusBrigadirJ,sementaraituDahlanIskanmenuliskanrahasiabesarsoalkasusBrigadirJ,hinggaselainpelecehanseksualDahlanjugamenuliskansoalurusancintaPutriCandrawathi.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarBacaJuga:5BeritaTerpopuler:BharadaESudahBicara,CampurTanganFerdySamboTerungkap,MasihAdaKejutanLainKolumniskondangDahlanIskanpunpenasarandenganmotifdibalikkasuspembunuhanYosuaHutabarataliasBrigadirJdirumahmantanKadivPropamPolriIrjenFerdySambo.MelaluitulisanberjudulMendungUdandikolomDisway,DahlanmulanyamenyinggungtentangskenariopelecehanseksualhinggasoalhubungancintaBrigadirJdengansangkekasihVeraSimanjuntak.DiapunmempertanyakanapakahistriFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.BacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?Bacaselengkapnya,kliklinkdibawah:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarRezaIndragiri.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenilaipemunculanistriIrjenFerdySambo,PutriCandrawathidiMakoBrimob,KelapaDua,Depok,Minggu(7/8)sebagaiproblematik.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalituterkaitbenartidaknyaterjadikejahatanseksualolehBrigadirJterhadapPutriCandrawathidirumahdinasmantanKadivPropamPolri,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.PutriCandrawathi(kanan)didepanMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianBacaJuga:DahlanIskanSinggungSkenarioPelecehanSeksualPutriCandrawathidanUrusanCintaRezamengatakandariseluruhkorbankecelakaanlalulintas,15persenmengalamiguncanganjiwa.Sementaraitu,dalamkasuskejahatanseksual,korbanyangterguncangberatmencapai80persen.Satudatainisajasudahmenunjukkankeseriusankejahatanseksual.Korbansudahsepatutnyaditolong.Hak-haknyadipenuhi,ucapRezakepadaJPNN.com,Senin(8/8).BacaJuga:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarAkantetapi,lanjutReza,apakahdalamkasusDurenTigabenar-benaradakejahatanseksual?Tentuperlumenungguhasilinvestigasikepolisian.Namun,RezamelihatadayangproblematikdaripemunculanistriFerdySambodidepanmediaketikamendatangiMakoBrimob.TerlebihPutridisebut-sebuttelahmengalamipelecehanseksual.

PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SuratIzinMengemudi(SIM)memilikimasaberlakuselama5tahunsetelahdibuat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});UntukandayangberdomisilidiJakartadaninginmemperpanjangdokumentersebut,DirektoratLaluLintasPoldaMetroJayamenyediakanlayananSIMKeliling.Dilansirdariakunresmi@TMCPoldaMetrodiInstagram,pihakPMJmenyiapkan5gerailayananSIMyangtersebardi4wilayahkotaDKIJakarta,Selasa(9/7).BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaPusatbisamemperpanjangSIMdiKantorPosLapanganBanteng.Kemudian,wargayangtinggaldiwilayahJakartaBaratpelayananSIMkelilingdibukadiLTCGlodokdanMallCitraland.BagiyangberdomisilidiJakartaSelatanbisamengaksesSIMkelilingdiKampusTrilogiKalibata.BacaJuga:LokasiLayananSIMKelilingdiJakartaHariIni,Ada5GeraiTerakhir,wargaJakartaTimurbisamenujukeGrandMallCakung.LayananSIMKelilinginiberoperasimulaipukul08.00hinggapukul14.00WIB.SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.

qq slot terbaru 2019 cashback 100-🎖️cara login rajapoker88 di android|XOXE88.COM

DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.

KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.

IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.

qq slot terbaru 2019 cashback 100-🎖️cara login rajapoker88 di android|XOXE88.COM

Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambat

BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitraland

HotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.

VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.

ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KetuaIndonesiaPoliceWatch(IPW)SugengTeguhSantosomendukunglangkahKapolriJenderalListyoSigitPrabowoterkaitpenanganankasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KasusituinisemuanyaditanganiBareskrimPolri,mulaidarikasuskematian,dugaanpembunuhanberencanaterhadapBrigadirJ.KemudiandugaanpelecehandanancamanpembunuhanyangdialamiPutriCandrawathi,istriIrjenFerdySambo.MenurutSugeng,sudahsaatnyaPolrimenjeladlankepadapublikapayangsebenarnyaterjadidalaminsidenbakutembakdirumahIrjenFerdySamboitu.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanSugengmenyebuthalituperlukarenaBrigadirJdanBharadaEbukanyangsebatasajudanIrjenFerdySambo.KeduapolisiitumerupakananggotaSatuanTugasKhusus(Satgassus)PolribentukanKapolri.DaripenelusuranIPW,BrigadirJyangtewasditembakmerupakananggotasatgassus.LaluBharadaRichardEliezerjugaanggotasatgassus,kataSugeng.BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolKemudianinsidenberdarahiniterjadidirumahdinasIrjenFerdySamboyangjugasebagaiKetuaSatgassusPolritersebut.Olehsebabitu,KapolriharustegasmenanganikasusinisesuaiperintahPresidenJokowiuntukdiproseshukum,terbuka,danjanganditutup-tutupi,ujarSugeng.PenampakanpesawatelektrikEHang216yangberencanadioperasikansebagaitransportasiumumdiIndonesia.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengusahaRudiSalimberencanamembangunbisnistaksiterbangdiIndonesia.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});SahabatRaffiAhmaditubakalmenjadikanpesawatelektrikEhang216sebagaitaksiterbang.LantasberapasebenarnyahargaEhang216?BacaJuga:BamsoetDukungPengadaanEHang216sebagaiOfficialAircraftIMIRudiSalimengganblak-blakanmengenaihargaasliEhang216.Namun,diamembuatperumpamaanterkaithaltersebut.Kisaranlebihmurahdarisupercar,deh,pokoknya,kataRudiSalimsaatditemuidikawasanKemayoran,JakartaPusat,Minggu(31/7).RudiSalimmengatakanbiayaperawatanEhang216jugatergolonglebihmurahdaripadapesawatkonvensional.BacaJuga:RudiSalimBerencanaBangunBisnisTaksiTerbangdiIndonesiaSebab,Ehang216beroperasimenggunakandayalistrik.Tenagalistrikyangdiperlukanuntuksatupesawateletrikinijugadisebuttidakbesar.Jadi,sangataffordable,imbuhnya.BhayangkaraDuaRichardEliezeratauBharadaEdikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardojpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatinsidenpolisitembakpolisidirumahKadivPropamnonaktifIrjenFerdySamboternyatatelahkembalikekesatuanasalnya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalitudiungkapkanKepalaDivisiHumasPolriIrjenDediPrasetyodiJakarta,Minggu(31/7/2022).DiamenyebutkanalasanBharadaEkembalikeBrimobkarenayangbersangkutanmasihberstatussebagaisaksidalamkasuspolisitembakpolisi.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriYa,karenastatusnyamasihsebagaisaksi,kataDedi.IaengganmenjelaskanlebihdetailterkaitdenganalasanpenarikanBharadaEkeMakoBrimob.Sementaraitu,BharadaRichardEliezeratauBharadaEdiketahuisebagaianggotaBrimobyangdiperbantukandiDivisiPropamPolridanmenjadiajudanIrjenPol.FerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhBharadaEdidugaterlibatbakutembakdenganBrigadirNofriansyahYosuaHutabaratatauBrigadieJdirumahKadivPropamPolriIrjemPol.FerdySambodiDurenTiga,JakartaSelatan,Jumat(8/7).Kepolisianmenanganitigalaporandalamperistiwatersebut,yakni:pertama,laporanberkenaandengandugaanpelecehanseksualataupencabulan;kedua,berkenaandengandugaanpengancamandankekerasansertapercobaanpembunuhan.KapoldaMetroJayaIrjenFadilImran.Foto:DokumenJPNN.com/Ricardojpnn.com,JAKARTA-KabidHumasPoldaMetroJayaKombesEndraZulpanmengatakanpihaknyatelahmenghentikanpenyidikankasuspenyuntinganprofilKapoldaIrjenFadilImrandilamanWikipediasehinggamenjadihoaks.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Penghentiankasustersebutsesuaidengankeputusankapoldayangtelahmemaafkanpelaku.Kasusnyadihentikan,kataEndraZulpandiJakarta,Minggu.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuDiamenambahkanpelakuyangdiketahuibernamaNyomansaatinitidakdilakukanpenahanandantelahdipulangkankerumahnya.Iya,sudahdipulangkan,ujarZulpan.PelakudiketahuisebelumnyatelahbertemudenganIrjenFadilImran.BacaJuga:IdentitasPelakuPembunuhanMayatTerlilitLakbanTerungkap,DiaTernyataPertemuankeduanyaitujugadiabadikandalamunggahanmelaluiakunKapoldaMetroJayadiInstagram.Dariawalsayajugatidakpernahmelaporkan,tidakmerasasakithatisamasekalidenganeditan-editanNyomanitu,tidakada,kataFadilImrandalamunggahanvideotersebut.

PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.IlustrasiFoto:Ricardojpnn.com,JAKARTA-PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});JabatanitulalutetapdipakaiolehKapolriselanjutnyasampaisaatini.PembentukansatgasinidibuatsejakKapolridijabatJenderalTitoKarnavianhinggaberlanjutkepadaIdhamAzisdankiniListyoSigit,kataEdidalamketerangannya,Minggu(31/7).BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDirekturEksekutifLemkapiitumenerangkankasatgassushanyabisadifungsikanolehKapolrisewaktu-waktudiperlukan.Diamencontohkansatgasinidiperlukansaatadagangguanperekonomiannasional.Meskidemikian,menurutEdi,jabatankasatgasadalahposisitambahanpejabatKadivPropamPolri.BacaJuga:AutopsiBrigadirJDilaksanakanHariIni,KapolriBicarasoalTanggungJawabSaatjabatanKadivPropamPolridicabut,makadengansendirinyaposisikasatgassusotomatisakanhilang.DanhalituberlakuterhadapIrjenFerdySambo.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirekturEksekutifLemkapiEdiHasibuanmeragukanpendapatsejumlahpihakbahwaIrjenFerdySambobisamengintervensipenyidikankasuspenembakanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutEdi,penanggungjawabtimkhususyangdibentukKapolriJenderalListyoSigitPrabowoituialahWakapolriKomjenGatotEddyPramono.TanpamengurangirasahormatsayadenganFerdySambo,diatidakbisamenekanapalagiintervensidalamkasusini.ApalagiketuatimkhususPolrisendiriadalahWakapolriKomjenGatotyangnotabeneadalahjenderalbintangtiga,katadia.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaSelainWakapolri,timkhususjugadiisiIrwasumKomjenAgungBudiMaryoto,KabareskrimKomjenAgusAndrianto,danKabaintelkamKomjenAhmadDofiri.Jadi,logikanya,bagaimanamungkinjenderalbintangduatanpajabatanbisaintervensiWakapolri,Katadoktorilmuhukumitu.Edijugamenyampaikanbahwajabatankepalasatgaskhusus(Kasatgassus)yangdisandangIrjenFerdySambosudahmenghilangsetelahkedudukanyangbersangkutansebagaiKepalaDivisiPropamPolridinonaktifkan.BacaJuga:LemkapiAnggapPutusanPDTHBrotosenoPenuhiRasaKeadilanSaatjabatanKadivPropamPolridicabut,makadengansendirinyajabatanKasatgasyangdisandangnyaotomatisakanhilang,kataEdi.Menurutnya,jabatankasatgasmerupakanposisitambahanKadivPropamPolri.

VerrellBramasta.Foto:Instagram/bramastavrljpnn.com,JAKARTA-AktorVerrellBramastadilarikankesalahsaturumahsakitbaru-baruini.Diaharusmenjalaniperawatanlantaranmengalamicederadibagianwajah.Akusekaranglagidirumahsakit,kemarinakujatuh,kataVerrelllBramastamelaluiakunmiliknyadiInstagram,Minggu(31/7).BacaJuga:CiumTangan,AldiTaherMintaMaafkepadaDinarCandyMantanpacarNatashaWilonaitumengakumengalamilukaaliasrobekdibagiandekatalis.VerrellBramastamenyebutlukatersebutakibatterbenturdenganfirehydrant.Akulukarobek,kenafirehydrant,jelaspemainsinetronPutriuntukPangeranitu.BacaJuga:SeringaiKembali,LaluSuarakanProtesuntukKominfoVerrellBramastaketakutanlantaranlukatersebutharusdijahitolehtenagamedis.Demimenghilangkanrasatakut,cowok25tahunitumemilihmelakukansiaranlangsungdiInstagram.Joshua,pembocordatarahasia.IlustrasiFoto:Antarajpnn.com,JAKARTA-KementerianKomunimasidanInformatika(Kemenkominfo)akhirnyabukasuaramengenaidatapenggunayangbisadilihatsetelahmendaftarkanpenyelenggarasistemelektronik(PSE).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});Diamenegaskantidalbisamelihatdatapenggunameskipunsudahmendaftarkan.Menurutdia,aksesdatapribadipenggunahanyabisadilakukanolehaparatpenegakhukumdaninstansiyangmemilikikewenangan.BacaJuga:KemenkominfoBlokirSejumlahPlatformLuarNegeri,SandiagaUno:TidakBisaSeenaknyaAktivitasitupunharusdalamkondisitertentu.Kamitidakbisamelihatdatapribadisepetipercakapan,kataDirekturJenderalAplikasiInformatika,Kominfo,SemuelAbrijaniPangerapan,dalamjumpapersvirtual,Minggu(31/7).MenurutSemuel,kondisiyangmembuatsebuahlembagabisamemintadatakepadaPSEantaralainadalahuntukmengungkapkejahatan.BacaJuga:KemenkominfoBlokirSteamHinggaOriginKarenaHalIni,Simak!DiamencontohkanPusatPelaporandanAnalisisTransaksiKeuangan(PPATK)bisamemintainformasikepadaPSEuntukmembuktikanpraktikpencucianuang.(Pihak)yangmemintadataharuspunyakewenangan.Kominfotidakuntukitu,kataSemuel.

KuasahukumkeluargaIrjenFerdySambo,ArmanHanis,menyangkanperlakuanpublikterhadapkliennya.DokInstagramKadivPropamPolri.jpnn.com,JAKARTA-KuasaHukumIstriIrjenFerdySambo,ArmanHanismengingatkanpublikdanmediabahwakliennyaadalahkorbantindakpidanakekerasanseksual.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menurutdia,haltersebutkiniseolahtenggelamakibatberbagaiisuliaryangberkembangterkaitkematianBrigadirJ.Segalaisu-isuyangadamembuatdugaantindakpidanakekerasanseksualmalahmenjaditenggelam,padahalnegarayangkitacintaiinimenganutasaskemanusiaanyangadildanberadab,kataArmandalamketerangannyapadaMinggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataArmanmengatakansetiapperempuanrentanmenjadikorbanTPKS,bahkanseorangistrijenderalsekalipun.Diapunmengingatkansemuapihakbahwadalamkasuskekerasanseksual,perspektifkorbanharusdiutamakan.Bahwaapayangterjaditerhadapklienkamisaatiniharusdipercayaisampaiterbuktisebaliknya,jelasdia.BacaJuga:FerdySamboHanyaJenderalBintang2,TidakMungkinBisaMenekanKomjenGatotdkkOlehkarenanya,ArmanberharaptimkhususyangdibentukKapolriJenderalListyoSigitPrabowodapatmengungkapkasusinisecaratuntasdantransparan.HalitusebagaimanaperintahPresidenJokoWidodo(Jokowi),bahwakasusiniharusdiselesaikandanjanganadayangditutup-tutupi.AsnawiMangkualam(depan)saatmembelaAnsanGreeners.Foto:Facebook/AnsanGreenersFCjpnn.com,ANSAN-AsnawiMangkualamberhasilmelanjutkantrenpositifnyabersamaAnsanGreeners.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Terkini,diabarusajamencetakgolkeduanyabagitimberjulukTheGreenWolvestersebut.HalituterjadiketikaAnsanmenangtelak3-0atasJeonnamDragonsdiAnsanWaStadium,Minggu(31/7/2022),padalanjutanKLeague2ataukompetisikastakeduaLigaKorea.BacaJuga:TimBuluTangkisPersembahkanMedaliEmasPertamauntukIndonesiapadaAjangASEANParaGames2022AsnawimencetakgolpertamaAnsandilagaini,tepatnyamenit59,sedangkanduagolsisanyadibukukanolehbraceThiagoHenrique(68,72).Seusailaga,Asnawimengakupergantianpelatihturutmendongkrakpenampilannya.KepecayaandirinyameningkatsetelahAnsanGreenersdilatiholehLimJong-heon.BacaJuga:MenporaAmaliBicaraKesuksesanEkonomidiExpoUMKMASEANParaGames2022Pergantianpelatihturutberpengaruh(penampilannya,red).Sayamakinpercayadiridanmemangsayaakuikondisisayabelummaksimalpadaawalmusim,ucapAsnawiseusailaga.Sayakinimakinpercayadiriberkatkepercayaanyangdiberikanpelatih,imbuhnya.

NikitaMirzanikembalisindirNindyAyunda.Ilustrasi.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-AktrisNikitaMirzanikembalimenyindirpenyanyiNindyAyundadimediasosial.SindiranituterkaitprotesyangdilayangkanNindypadasalahsatumedia.Banyakomonglu,NindyAyunda,tulisNikitaMirzanimelaluiakunInstagramputranya,Azka,Minggu(31/7).BacaJuga:NikitaMirzaniKembaliSerangNindyAyundaGegaraMasalahIniPesohorkelahiran17Maret1986inijugamenyinggungsikapNindyyangselalumenghindariawakmedia.Makanyakalauketemumediajangankaburlu.Gilirandiberitakanmedia,ngamuk,lanjutNikita.Sebelumnya,NindyAyundamengunggahsebuahtangkapanlayarpemberitaandirinyayangbakaldijemputpaksapolisi.BacaJuga:BaimWongDaftarkanCitayamFashionWeekkeHAKI,NikitaMirzaniBerkomentarBeginiNindymelaluiakunnyadiInstagram,takterimadiberitakansepertiitudanmemberiperingatankemediatersebut.MantanistriAskaraParasadyHarsonoitupunmemintamediatersebutuntukmenurunkanpemberitaantersebut.MenporaZainudinAmali.Foto:HumasKemenporajpnn.com,SOLO-MenporaZainudinAmalimengungkapkanbahwapenyelenggaraanASEANParaGamesSolo2022merupakanbentukperhatianPresidenJokoWidodo(Jokowi)terhadapatlet-atletdifabel.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Pasalnya,ajanginisudahempattahunatauduakalisecaraberturut-turuttidakdiselenggarakan.ASEANParaGames2022seharusnyatuanrumahadalahVietnam.Namun,merekatidakbersediamenyelenggarakanajangolahragaparalimpiktingkatAsiaTenggaraini.BacaJuga:ApaAlasanPenarikanBharadaEkeMakoBrimob?IrjenDediJawabBeginiAwalnyabukankitatuanrumahnyatapiVietnam.Karenanegara-negaralaintidakbersediamenyelenggarakan,makaatasarahanBapakPresidenJokoWidodountukmengajukandirimenjadituanrumah,kataMenporaAmali.MenporaAmalipunmenjelaskanalasanJokowimemberiarahankepadadirinyauntukmengambilkesempatanmenjadituanrumahASEANParaGameskarenainiakanmenjadiajangbagiparaatletdifabeluntukberkompetisidalammeraihprestasi.Sebab,paraatletparagameskesempatannyauntukbertandingsangatterbatas,terlebihsejumlahajangmultieventharusditiadakandanditundasepertiASEANParaGamesFilipina2019,AseanParaGamesVietnam2022,danAsianGamesGuangzhouyangditundaketahun2023.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDisisilain,ajangsingleeventjugasangatterbatas.OlehkarenaituPakPresidenJokoWidodomemberiarahankepadasayauntukmemberimerekaarenauntukbertanding.BelumtentukalaukitatidakjadituanrumahASEANParaGames2022initerlaksana,katanya.KadivHumasPolriIrjenDediPrasetyoakuiBHaradaEditarikkekesatuanBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatbakutembakyangmenewaskanBrigadirYosuaHutabarat(BrigadirJ)dirumahKadivPropamnonaktifPolriIrjenFerdySambo,ditarikkekesatuannya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenbakutembakantaraBharadaEdenganBrigadirJkononterjadidirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatanpadaJumat(8/7).KepalaDivisiHumasPolriIrjenDediPrasetyopunmengakuipenarikanBharadaEkekesatuanbrigademobil(Brimob).BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolYa,karenastatusnyamasihsebagaisaksi,kataIrjenDedidiJakartapadaMinggu(31/7).Namun,jenderalbintangduaitutidakmemerincialasankesatuanmenarikBharadaE.BharadaEliezeratauBharadaEmerupakananggotaBrimobyangdiperbantukansebagaiaidedecamp(ADC)atauajudanIrjenFerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhAnggotaBrimobitubelakanganmenyitaperhatianpubliksetelahdisebutpolisiterlibatbakutembakdenganBrigadirJ.PolisimenyebutbakutembakitudipicudugaanpelecehanseksualdanpenodonganpistololehBrigadirJterhadapistriFerdySambo,PutriCandrawathi.KadivHumasPolriIrjenDediPrasetyodiMabesPolri,Jakarta,Rabu(20/7).Foto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeratauEditarikdarijabatanajudanIrjenFerdySambomenjadianggotaKorpsBrimobPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KabarpenarikanBharadaEkeKorpsBrimobinidibenarkanolehKadivHumasPolriIrjenDediPrasetyo.Ya(ditarikkeBrimob),karenastatusnyamasihsebagaisaksi,kataDedikepadawartawan,Minggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataSosokBharadaEdiketahuiikutterseretdalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.BharadEdisebutsebagaipenembakBrigadirJdirumahdinasIrjenFerdySambo.PenarikankeKorpsBrimobinidilakukanditengahprosespenanganankasuskematianBrigadirJmasihberjalan.BacaJuga:LawyerKeluargaSambo:IstriJenderalJugaBisaJadiKorbanPelecehanDedipuntidakmemerinciapaasalanutamaBharadaEditarikdariajudanIrjenFerdySambo.AdapunbakutembakantaraBharadaEdenganBrigadirJterjadidirumahdinasIrjenFerdySambodiDurenTiga,KecamatanPancoran,JakartaSelatan,Jumat(8/7).

KabareskrimPolriKomjenAgusAndriantosaatturundarimobildinasnyadidepanrumahIrjenFerdySambo,Senin(1/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-SejumlahpetinggiPolrimenyambangirumahdinasKadivPropamPolrinonaktifIrjenFerdySambo,diDurenTiga,JakartaSelatanpadaSenin(1/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Rumahtersebutmerupakantempatkejadianperkara(TKP)bakutembakBrigadirNofryansahYosuaHutabaratatauBrigadirJdenganBharadaE.PantauanJPNN.comdilokasi,sekitarpukul10.46WIB,KabareskrimPolriKomjenAgusAndriantoyangnotabeneanggotatimsusyangdibentukKapolriJenderalListyoSigitPrabowotibadilokasi.BacaJuga:KabarTerbaruKasusBrigadirJ,JenderalBintang2IkutkeTKPBakuTembak,LihatItuJenderalpolisibintangtigaitutampakmengenakankemejaputih.KomjenAgusAndriantotakmemberikanpernyataanapapunsaatturundarimobildinasnyayangberwarnahitam.Sebelumnya,KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyohadirterlebihdahulu.BacaJuga:KabarTerbaruKasusIstriFerdySambo,PolrijugaPenginCepatKelarSaatini,keduajenderalitutelahmasukkerumahdinasIrjenFerdySambo.AdapunsebagianpetugaskepolisiantampakberadadiluargerbangrumahdinasIrjenFerdySamboitu.PTPanasonicGobelIndonesia(PGI)menggelarpromoPanasonicBagi-bagiKebahagiaanbagiseluruhpelanggansetia,yangdimulaidari18Juli2022hingga31Oktober2022.FotoPGIjpnn.com,JAKARTA-PTPanasonicGobelIndonesia(PGI)kembalimenggelarprogrampromoPanasonicBagi-bagiKebahagiaanbagiseluruhpelanggansetia,yangdimulaidari18Juli2022hingga31Oktober2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});PromoPanasonicBagi-bagiKebahagiaaninimerupakanwujudnyataPGIdalammemberikanprodukjugalayananterbaikbagipelangganuntukmendapatkankesempatancashbackhingga50%,padasetiappembelianproduk-produkPanasonicmelaluiWheelofHappiness(WoH).KeisukeNakagawa,PresidentDirectorPTPanasonicGobelIndonesiamengatakan,inisiatifpromodipertengahantahuninidiberikantanpamelihatadanyaharispesialataupuntanggalcantik,karenasalahsatuorientasibisnisPanasonicGOBELadalahmeningkatkankepuasanpelanggan.BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangPanasonicterusberupayamenciptakanLiveYourBestmelaluisetiapinovasilayanandenganmengadakanprogrampromoPanasonicBagi-bagiKebahagiaan,agardapatberkontribusidalammemberikankebahagiaandankesejahteraanbaikbagikonsumenmaupunmasyarakatdiseluruhIndonesia,ujarKeisukeNakagawa.Untukmendapatkanpromoinicaranyasangatmudah,konsumentinggalmembelisalahsatuproduk-produkfavoritPanasonic.Kemudiansetelahmelakukanpembayaran,setiappelangganberkesempatanmendapatkanpotonganhargadenganmelakukanSpinTheWheelsofHappinessdiwebsitebagibagikebahagiaan.com,ataudapatmengaksesdenganscanQRCodepadaBanneratauMateriPromosiyangadadisetiaptoko.BacaJuga:MenparekrafSandiagaBantuWargaKubuRayaTingkatkanPenghasilanLewatLidahBuayaTerpurukKarenaPandemi,2UMKMdiBaliIniBerhasilBangkitBerkatGoDigitalLangkahkedua,isibiodata,kategoriproduk,nomormodelproduk,nomorseri,tokopembelian,nomorkartugaransi,fotokartugaransisertafotoinvoice,danlangsungputarWheelsofHappinessuntukmendapatkancashbackdariRp25.000hinggaRp3.000.000,-dalambentukvouceryangakandikirimkankenomorteleponataue-mailyangsudahdidaftarkan.Kamiinginselalumemberikankejutandankebahagiaanbersamakonsumenmelaluiberbagaipromoyangkamibuat.MelaluiPanasonicBagi-bagiKebahagiaandiharapkandapatmemberikanmanfaatkepadasemuaorang,termasukpelanggansetiaPanasonic,seruMarketingDirectorPTPanasonicGobelIndonesiaYukiHonda.(chi/jpnn)

PutriZulkifliHasan,FutriZulyaSavitriresmiberceraidenganAhmadMumtazRais.Foto:FirdaJunita/JPNNjpnn.com,JAKARTA-PutrapolitikusAmienRais,AhmadMumtazRaisresmiberceraidenganFutriZulyaSavitri.Adapunpenyebabutamakeduanyaberceraiyaknilantaransudahtidakadalagikeharmonisandalamrumahtangga.HalinitercatatdalamsuratputusanceraiMumtazdanFutriyangdiunggahdiwebsiteMahkamahAgungRepublikIndonesia.BacaJuga:PutriZulkifliHasandanMumtazRaisResmiBercerai,BeginiIsiPutusannyaBerdasarkanketerangandalamsuratputusantersebut,keduabelahpihakdinyatakanseringribut.Awalnya2011,lantas2018,kemudian2020,selanjutnyabertengkarlagi2021,begitutertulisisiketerangandalamsuratputusanceraiMumtazdanFutri,dikutipSenin(1/8).Keduabelahpihakdisebutkantelahberupayauntukmenyelesaikanperselisihanyangterjadidalamrumahtangga.BacaJuga:5PernyataanMumtazRaisSoalRumahTangganyadenganPutriZulhas,Nomor2TegasBanget!Namun,padaakhir2021,hubungankeduanyajustrusemakinmemburuk.Haliniterbuktidaritidakadanyakomunikasiantaraduabelahpihak.Tidaksalingbertegursapaantarapenggugatdengantergugat,lanjutisiputusantersebut.DuapriayangdidugaajudanKadivPropamnonaktifIrjenFerdySambosaattibadikantorKomnasHAM,Menteng,JakartaPusat,Senin(1/8).Foto:RyanaAryaditaUmasugi/JPNN.comjpnn.com,JAKARTA-Sejumlahaidedecamp(ADC)aliasajudandanasistenrumahtangga(ART)KadivPropamPolrinonaktifIrjenFerdySambomendatangikantorKomisiNasionalHakAsasiManusia(KomnasHAM).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MerekadatangdanmemasukikantorKomnasHAMdiMenteng,JakartaPusat,sekitarpukul10.15WIB,padaSenin(1/8).KedatanganparaajudanFerdySamboitudalamrangkamemenuhipanggilanKomnasHAMyangmasihmemerlukanketeranganterkaitinsidenpolisitembakpolisiyangmenewaskanBrigadirJ.BacaJuga:KabarTerbaruKasusBrigadirJ,JenderalBintang2IkutkeTKPBakuTembak,LihatItuTerlihatsalahsatuajudanmengenakankauskerahabu-abuhitamlengkapdenganmaskerhitamdantopiberwarnasenada.Kemudianpriayangdidugaajudanlainnyamengenakankemejahitamdenganmaskerberwarnasama.Selainitu,priayangberjalanpalingterakhirmemakaikauskerahbirumuda,BacaJuga:KabarTerbaruKasusIstriFerdySambo,PolrijugaPenginCepatKelarAdajugaseorangperempuanyangmemakaiblusputihdenganhijabhitambermotif.MerekamasukdikawalolehtimpengamanandanstafdariKomnasHAM.

PutraAmienRais,AhmadMumtazRais.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-KelakuanPutraAmienRais,AhmadMumtazterbongkardalamrangkaiansidangceraidenganFutriZulyaSavitri,beberapawaktulalu.Dalamsidangcerai,FutrimembeberkansejumlahfaktamengenaisosokAhmadMumtazsaatmenjadisuaminya.DeretanfaktatersebuttercatatdalamsuratputusanceraiMumtazdanFutri,yangdiunggahdilamanMahkamahAgungRI.BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangDalamsuratputusancerainya,Mumtazdisebutmemilikikebiasaanmengonsumsiminumankeras.Kebiasaaniturupanyayangkerapmenjadisalahsatupemicupertengkarankeduanya.Prosesakhirnyaadalahterjadipertengkaranatauperselisihanantarapenggugatdantergugat,begitutertulisisisuratputusanceraiMumtazdanFutri,Senin(1/8).BacaJuga:PutraAmienRaisResmiBercerai,SebeginiNafkahyangHarusDiberikanKepadaMantanIstriImbasnya,Futriseringmendapatkankekerasandalamrumahtanggaakibatpertengkarantersebut.Taksangguplagimendapatsiksaanjasmanidanrohani,Futrimemutuskanmengajukangugatanceraikepengadilanagama.KuasahukumBharadaE,AndreasNahotSilitongamenyesalkanberbagaipernyataanterkaithasilautopsijenazahBrigadirJdikantorLPSK,Ciracas,JakartaTimur,Senin(1/8)Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-KuasahukumBharadaE,AndreasNahotSilitongamenyesalkanadanyabeberapakomentaryangdinilainyaliarsoalautopsiulangjenazahBrigadirNofryansahYosuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DiamenyebutkanhasilautopsibelumdikeluarkanolehyangahlidibidangnyadalamhalinidokterforensikyangmelakukanautopsiterhadapBrigadirJ.Yangkamisayangkanpemberitaanyangberedar,yangmenurutkamipihaktidakbertanggungjawab.Bukanahlidibidangnyamenyampaikanpendapatyangseakan-akanbenar.Itusangatdisayangkan,kataAndreaskepadawartawandiKantorLPSK,Ciracas,JakartaTimur,Senin(1/8).BacaJuga:RabuNanti,KomnasHAMPeriksaUjiBalistikSenjatayangMenewaskanBrigadirJDiamenyebutkanseharusnyasemuapihakmengikutiproseshukummaupunpenyidikansecarakooperatif.Timforensikyangahliitubutuh4-8minggu.Namun,kitadengarpernyataandaripenasihathukumYosuaseakan-seakansudahbenarsemua,itukamisayangkan.Kamikooperatifdantidakadaditutupi,diamelanjutkan.AdapunpernyataanyangdimaksudialahsoaltemuanautopsiulangBrigadirJyangdisebutkanadalukatembakandarihidungmenembuskepala.BacaJuga:FaktaBaru,BekasdiLeherBrigadirJBukandariJeratanTali,TetapiIya(pernyataanitusalahsatunya).Ituseakan-akansudahkeluaratauhal-halyangdisampaikankepublik,dariforensiksajabutuh4-8minggu.Ituyangkamisayangkan,jelasdia.Andreasjugamemintakepadaseluruhpihakuntukmengikutiproseshukumdanpenyidikansecaradisiplindanmengedepankanrasasimpati.

Iklan Bawah Artikel